PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 311aa    MW: 35523.5 Da    PI: 8.2024
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-13853146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l + vk++G+++W++I ++  + Rt+k+c++rw +
   XP_009630342.1  8 KGPWKAEEDEVLRKHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 53
                     79*************************8887799**********87 PP

2Myb_DNA-binding44.34e-1464103344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
   XP_009630342.1  64 KFSAEEERTVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 103
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.879359IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-21456IPR009057Homeodomain-like
SuperFamilySSF466894.12E-286103IPR009057Homeodomain-like
SMARTSM007173.4E-11757IPR001005SANT/Myb domain
CDDcd001671.32E-111055No hitNo description
PfamPF139211.5E-131171No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1857109IPR009057Homeodomain-like
PROSITE profilePS5129417.23460111IPR017930Myb domain
SMARTSM007173.0E-1261109IPR001005SANT/Myb domain
CDDcd001678.41E-1164103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSDSMIKKGP WKAEEDEVLR KHVKKYGPRD WSSIRSKGLL QRTGKSCRLR WVNKLRPNLK  60
SGVKFSAEEE RTVIELQAQF GNKWARIATY LPGRTDNDVK NFWSSRQKKL ARILRTSVQQ  120
PSKPQKTNNR EAPALQKHPS VEGPKLSSLA EERSLSISQY CPSSYMNNCN TINMVQLPEL  180
LNSTSLPFEP DLLQPEFNPY EKRACFGSQI PLPFPQIPLQ TDFLHPLESQ ILPMKLEESD  240
FLDFFGQLSA SEIGNVQVPF VPSSCSGPER SSDIISVKRE IDIPLTPDSF IDDFPMDMFD  300
HIDPLPSPFN W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-26610525122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0325371e-115AB032537.2 Nicotiana tabacum B25 mRNA for hypothetical protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630342.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016497849.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLK4AYZ41e-162K4AYZ4_SOLLC; Uncharacterized protein
STRINGSolyc01g090530.1.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42072342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.18e-79MYB family protein